PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015868935.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family HSF
Protein Properties Length: 217aa    MW: 23803.2 Da    PI: 8.2424
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015868935.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind75.59.7e-241877261
                    HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
    HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61
                    Fl k+y++++d++++e++sws+ ++sfvv+++ efa+ +Lp++Fkh+nf+SF+RQLn+Y 
  XP_015868935.1 18 FLLKTYDMVDDSSTDEIVSWSSVKTSFVVWNPPEFARLLLPTFFKHNNFSSFIRQLNTYT 77
                    9**********************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.7E-251177IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467855.03E-221478IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004154.9E-271497IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.3E-131841IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004474.2E-201877IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.3E-135668IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.3E-136981IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF533835.72E-3578208IPR015424Pyridoxal phosphate-dependent transferase
PfamPF004641.5E-2779157IPR001085Serine hydroxymethyltransferase
Gene3DG3DSA:3.90.1150.101.7E-5180209IPR015422Pyridoxal phosphate-dependent transferase, major region, subdomain 2
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016740Molecular Functiontransferase activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MDGAQAAGSG SSGGPAPFLL KTYDMVDDSS TDEIVSWSSV KTSFVVWNPP EFARLLLPTF  60
FKHNNFSSFI RQLNTYTSPH KLVTGGTENH LVLWDLRPLG LTGNKVEKLC DLCNITVNKN  120
AVFGDSSALA PGGVRIGTPA MTSRGLLEKD FEQIGEFLHR AVTITLSIQK EHGKLLKDFN  180
KGLGKNKDIE ALKADVEKFS SSFHMPGFQM SAMKYKD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1bj4_A1e-3680208337470PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015868935.11e-161PREDICTED: serine hydroxymethyltransferase 4-like
SwissprotO232541e-78GLYC4_ARATH; Serine hydroxymethyltransferase 4
TrEMBLA0A067DKJ38e-88A0A067DKJ3_CITSI; Serine hydroxymethyltransferase (Fragment)
TrEMBLB9S9Y74e-85B9S9Y7_RICCO; Serine hydroxymethyltransferase
STRINGPOPTR_0001s32770.14e-84(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13980.12e-28HSF family protein